Allele Report for DRB1*14:33

DRB1*14:33 View HGVS Report
Pre-2010 Nomenclature: DRB1*1433 Local Names: DRB1*LAM
IMGT/HLA Acc No: HLA01011 OMIM Entry: *142857
Assigned: 1998-12-26 Sequence Last Modified: 2003-07-12
Source Entries: AF112879 , AJ506201  
Cells Sequence Derived From: CB1 116643 , LB65292  
Known Ethnic Origin Of Source: Caucasoid
Publications
Anholts JD et al. Tissue Antigens 63:80-4 2004. (View abstract)
Trejaut J et al. Tissue Antigens 55:89-91 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR6
Comments: NN: DR14  
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGAGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo