Allele Report for DRB1*14:25

DRB1*14:25 View HGVS Report
Pre-2010 Nomenclature: DRB1*1425 Local Names: HL14V
IMGT/HLA Acc No: HLA00857 OMIM Entry: *142857
Assigned: 1995-12-10 Sequence Last Modified: 2003-07-12
Source Entries: AY174092 , U41490 , U41491  
Cells Sequence Derived From: H.S.DNA#16406 , HL.BWH , MF.BWH  
Known Ethnic Origin Of Source: Oriental
Publications
Ellis JM et al. Tissue Antigens 50:42-6 1997. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR6
Comments:
Protein Sequence (94 aa)
GDTRPRFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPAAEHWNSQKDFLEDRRAAVDTYCR
HNYGVGESFTVQRR
Nucleotide Sequence Data (283 bps)
GGGGACACCCGACCACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGACAGATACTTCTATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGG
GGCGGCCTGCTGCGGAGCACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGA
CACAACTACGGGGTTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo