Allele Report for DRB1*14:17

DRB1*14:17 View HGVS Report
Pre-2010 Nomenclature: DRB1*1417 Local Names: 1412T
IMGT/HLA Acc No: HLA00849 OMIM Entry: *142857
Assigned: 1994-01-10 Sequence Last Modified: 2003-04-17
Source Entries: AJ543433 , X76938  
Cells Sequence Derived From: #15310-LN , 12499  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hashemi S et al. Tissue Antigens 44:189-92 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR6 WHO Assigned Type: DR6
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1 DR13 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR6
Comments: DR14x13; DR13 weak, DR14 neg 
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo