Allele Report for DRB1*14:16

DRB1*14:16 View HGVS Report
Pre-2010 Nomenclature: DRB1*1416 Local Names: FVA-0166
IMGT/HLA Acc No: HLA00848 OMIM Entry: *142857
Assigned: 1993-12-21 Sequence Last Modified: 2003-04-17
Source Entries: AJ508388 , X76195  
Cells Sequence Derived From: 18573 , FVA-0166  
Known Ethnic Origin Of Source: Unknown
Publications
Anholts JD et al. Hum Immunol 42:15-22 1995. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR6 WHO Assigned Type: DR6
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1 DR14 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR13
Comments: DR14x13 
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDILEDERAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo