Allele Report for DRB1*14:15

DRB1*14:15 View HGVS Report
Pre-2010 Nomenclature: DRB1*1415 Local Names: DRB1*14af
IMGT/HLA Acc No: HLA00847 OMIM Entry: *142857
Assigned: 1993-11-26 Sequence Last Modified: 2004-07-08
Source Entries: AJ581744 , U02561  
Cells Sequence Derived From: D.M. , R03-353  
Known Ethnic Origin Of Source: Oriental
Publications
Fogdell A et al. Tissue Antigens 43:327-9 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR8 WHO Assigned Type: DR8
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 DR8 [50%] DR14 [26%] DR13 [8%]
NMDP (2008) 1 DR8 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR8
Comments: DR8+DR52 
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo