Allele Report for DRB1*14:12:01

DRB1*14:12:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*1412 Local Names: DRB1*14YOS
IMGT/HLA Acc No: HLA00844 OMIM Entry: *142857
Assigned: 1993-07-03 Sequence Last Modified: 2005-01-12
Source Entries: AY770520 , D16110  
Cells Sequence Derived From: AS03092603 , YOS  
Known Ethnic Origin Of Source: Oriental
Publications
Hashimoto M et al. Tissue Antigens 43:133-5 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: DR14(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR14
Comments: NN: DR6 
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEDRRALVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAAGACAGGCGGGCCCTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo