Allele Report for DRB1*14:06:01

DRB1*14:06:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*140601 Local Names: DRB1*14.GB, DRB1*14.6
IMGT/HLA Acc No: HLA00838 OMIM Entry: *142857
Assigned: 1991-07-17 Sequence Last Modified: 2006-01-12
Source Entries: AF029286 , AM109998 , AY050211 , AY050214 , L78164 , M63927 , M74032  
Cells Sequence Derived From: 24A3 , GB , GN00405 , GN00407 , SAS5041 , SAS9080 , SUDNA01649 , TER313  
Known Ethnic Origin Of Source: Caucasoid, Hispanic, Oriental
Publications
Gans CP et al. Tissue Antigens 59:364-9 2002. (View abstract)
Dong RP et al. Immunogenetics 36:130-3 1992. (View abstract)
Petersdorf EW et al. Tissue Antigens 38:169-77 1991. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: DR14(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 DR13 [28%] DR14 [26%] DR6 [19%] DR3 [11%]
NMDP (2008) 117 DR14 [37%] DR13 [22%] DR6 [15%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR6 DR14
Comments:
Protein Sequence (182 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
VESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (549 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAAT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo