Allele Report for DRB1*14:05:02

DRB1*14:05:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*140502 Local Names: None
IMGT/HLA Acc No: HLA01663 OMIM Entry: *142857
Assigned: 2002-09-30 Sequence Last Modified: 2002-10-14
Source Entries: AY129430  
Cells Sequence Derived From: 2247077-4  
Known Ethnic Origin Of Source: Oriental
Publications
Chen ZX et al. Tissue Antigens 64:300-3 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: DR14(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR14 [74-85%] DR6 [11-15%] DR3 [0-13%]
NMDP (2008) 58 DR14 [86%] DR6 [10%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCAATTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo