Allele Report for DRB1*14:01:03

DRB1*14:01:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*140103 Local Names: HAL-DRB1
IMGT/HLA Acc No: HLA02230 OMIM Entry: *142857
Assigned: 2005-06-25 Sequence Last Modified: 2005-07-12
Source Entries: DQ021915  
Cells Sequence Derived From: TW3  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR14 WHO Assigned Type: DR14(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 18 DR14 [91-100%] DR6 [0-7%]
NMDP (2008) 1942 DR14 [74%] DR6 [14%] DR13 [3%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR6 DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAAGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGC
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo