Allele Report for DRB1*13:28

DRB1*13:28 View HGVS Report
Pre-2010 Nomenclature: DRB1*1328 Local Names: DRB1*1301Like
IMGT/HLA Acc No: HLA00826 OMIM Entry: *142857
Assigned: 1996-07-17 Sequence Last Modified: 2013-01-18
Source Entries: JQ824771 , JX458903 , JX866722 , KF882470 , X97407  
Cells Sequence Derived From: DU25503 , HG00004749 , HG00004750 , HG00007070 , HG00008220  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR13
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYRV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACCGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo