Allele Report for DRB1*13:150

DRB1*13:150 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DRB1_110303_01025, HIS_NEW_DRB1_110303_01026
IMGT/HLA Acc No: HLA08871 OMIM Entry: *142857
Assigned: 2012-10-31 Sequence Last Modified: 2013-01-18
Source Entries: HG008009 , JX458907 , JX458908  
Cells Sequence Derived From: DKMS-LSL-DRB1-59 , HG00004767 , HG00004768  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVRELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGAGGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo