Allele Report for DRB1*13:101

DRB1*13:101 View HGVS Report
Pre-2010 Nomenclature: Local Names: DRB1*13:03 variant
IMGT/HLA Acc No: HLA05388 OMIM Entry: *142857
Assigned: 2010-06-30 Sequence Last Modified: 2010-07-16
Source Entries: FN821958 , JN604881  
Cells Sequence Derived From: 20090727106 , HG00005320  
Known Ethnic Origin Of Source: Unknown
Publications
Van Sandt VST et al. Tissue Antigens 78:45-48 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRSFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDKRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATCCTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo