Allele Report for DRB1*13:03:06

DRB1*13:03:06 View HGVS Report
Pre-2010 Nomenclature: Local Names: NT01156
IMGT/HLA Acc No: HLA05131 OMIM Entry: *142857
Assigned: 2010-04-30 Sequence Last Modified: 2010-07-16
Source Entries: HM021746  
Cells Sequence Derived From: NT01156  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Lazaro AM et al. Tissue Antigens 78:263-266 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDKRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGCCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo