Allele Report for DRB1*13:03:05

DRB1*13:03:05 View HGVS Report
Pre-2010 Nomenclature: DRB1*130305 Local Names: HistoGenetics HIS_NEW_DRB1_444_00195
IMGT/HLA Acc No: HLA04775 OMIM Entry: *142857
Assigned: 2010-02-22 Sequence Last Modified: 2010-04-01
Source Entries: FJ888508  
Cells Sequence Derived From: HN-52661-2  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDKRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo