Allele Report for DRB1*13:97:01

DRB1*13:97:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*1397 Local Names: HistoGenetics HIS_NEW_DRB1_379_00141
IMGT/HLA Acc No: HLA04668 OMIM Entry: *142857
Assigned: 2009-12-21 Sequence Last Modified: 2010-01-15
Source Entries: FJ766011 , GU320624 , JN119529  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*13:97:01
Submission 1
Submission 2
Submission 3

Locus Reference
  Virtual entry for DRB1*13:97:01 
  Individual submission(s) 
Cells Sequence Derived From: BY00644 , HG00004068 , HN-26392-8  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.4668 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEYVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors