Allele Report for DRB1*13:87

DRB1*13:87 View HGVS Report
Pre-2010 Nomenclature: DRB1*1387 Local Names: DRB1
IMGT/HLA Acc No: HLA03447 OMIM Entry: *142857
Assigned: 2008-07-30 Sequence Last Modified: 2008-10-10
Source Entries: FJ205619 , FM196526  
Cells Sequence Derived From: 30195 , HN-66888-8  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEIVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGV
VESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo