Allele Report for DRB1*13:85

DRB1*13:85 View HGVS Report
Pre-2010 Nomenclature: DRB1*1385 Local Names: BY00340
IMGT/HLA Acc No: HLA03410 OMIM Entry: *142857
Assigned: 2008-06-30 Sequence Last Modified: 2008-10-10
Source Entries: EU826130  
Cells Sequence Derived From: BY00340  
Known Ethnic Origin Of Source: Black
Publications
Lazaro AM et al. Tissue Antigens 76:319-324 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDKRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo