Allele Report for DRB1*13:60

DRB1*13:60 View HGVS Report
Pre-2010 Nomenclature: DRB1*1360 Local Names: SL06
IMGT/HLA Acc No: HLA01754 OMIM Entry: *142857
Assigned: 2003-06-13 Sequence Last Modified: 2003-07-12
Source Entries: AY178845  
Cells Sequence Derived From: SL06  
Known Ethnic Origin Of Source: Mixed
CWD v2.0 Status: Well-Documented
Publications
Testa GV et al. Tissue Antigens 63:617-8 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR6
Comments: DRB5*02 associated 
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACCTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo