Allele Report for DRB1*13:50:02

DRB1*13:50:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*135002 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA03182 OMIM Entry: *142857
Assigned: 2007-11-30 Sequence Last Modified: 2008-01-11
Source Entries: EU290674  
Cells Sequence Derived From: CB5046  
Known Ethnic Origin Of Source: Oriental
Publications
Yan LX et al. Tissue Antigens 72:78-9 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo