Allele Report for DRB1*13:38

DRB1*13:38 View HGVS Report
Pre-2010 Nomenclature: DRB1*1338 Local Names: 031188956
IMGT/HLA Acc No: HLA01151 OMIM Entry: *142857
Assigned: 1999-11-25 Sequence Last Modified: 2008-10-10
Source Entries: AF169239 , EU826134 , FJ594734 , FJ766009 , FJ875597 , FJ875608 , FJ952588 , GQ149339 , GQ180275 , GU590983 , GU590989  
Cells Sequence Derived From: 031188956 , HG00001942 , HG00002213 , HG10011851 , HN-11283-8 , HN-32101-5 , HN-61399-0 , HN-74601-2 , HN-8904109 , HN-96345-4 , NT00983  
Known Ethnic Origin Of Source: Mixed
Publications
Tang TF et al. Tissue Antigens 59:63-5 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 11 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR13
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDERAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACGGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo