Allele Report for DRB1*13:17

DRB1*13:17 View HGVS Report
Pre-2010 Nomenclature: DRB1*1317 Local Names: RB 1194 13/12
IMGT/HLA Acc No: HLA00815 OMIM Entry: *142857
Assigned: 1994-10-17 Sequence Last Modified: 2006-01-12
Source Entries: AM109994 , U03721  
Cells Sequence Derived From: R.B  
Known Ethnic Origin Of Source: Caucasoid
Publications
Rosenberg SM et al. Tissue Antigens 46:128-30 1995. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 DR13 [53%] DR8 [41%] DR11 [6%]
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not assigned
Comments: DR13x8; NN: DR8  
Protein Sequence (187 aa)
GDTRPRFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCR
HNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVM
LETVPRSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (562 bps)
GGGGACACCAGACCACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGACAGATACTTCTATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGG
GGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGA
CACAACTACGGGGTTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCA
GCCCCTGCAGCACCACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGA
ATGGCCAGGAAGAGAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATG
CTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGA
AT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo