Allele Report for DRB1*13:15

DRB1*13:15 View HGVS Report
Pre-2010 Nomenclature: DRB1*1315 Local Names: DRB1*83-7601
IMGT/HLA Acc No: HLA00813 OMIM Entry: *142857
Assigned: 1994-06-10 Sequence Last Modified: 2003-01-17
Source Entries: AY174182 , U08276 , U32325  
Cells Sequence Derived From: BRI-14 , GN070 , T.D.DNA#9107  
Known Ethnic Origin Of Source: Caucasoid, Mixed
Publications
Lin YS et al. Tissue Antigens 55:92-6 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR13
Comments:
Protein Sequence (88 aa)
FLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVV
ESFTVQRR
Nucleotide Sequence Data (266 bps)
TTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGATACTTCCATA
ACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGCCGAG
TACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGT
GGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo