Allele Report for DRB1*13:14:01

DRB1*13:14:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*131401 Local Names: DRB1*13141, DRB1*1101A58, DRB1*13New
IMGT/HLA Acc No: HLA00812 OMIM Entry: *142857
Assigned: 1994-06-10 Sequence Last Modified: 2003-07-12
Source Entries: AJ245717 , AY277393 , U08274 , X82239  
Cells Sequence Derived From: 11684232 , BRI-12 , GN00270 , YAS  
Known Ethnic Origin Of Source: Caucasoid
Publications
Blasczyk R et al. Hum Immunol 43:309-12 1995. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DR13 [69-77%] DR11 [0-15%] DR14 [0-9%] DR6 [0-5%]
NMDP (2008) 2 DR11 [50%] Blank [50%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo