Allele Report for DRB1*13:11:02

DRB1*13:11:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*131102 Local Names: BY00337
IMGT/HLA Acc No: HLA03407 OMIM Entry: *142857
Assigned: 2008-06-30 Sequence Last Modified: 2008-10-10
Source Entries: EU812540 , FJ907390  
Cells Sequence Derived From: BY00337 , HN-98756-7  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Lazaro AM et al. Tissue Antigens 76:319-324 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR13 [72-90%] DR11 [0-28%] DR14 [0-10%] DR6 [0-6%]
NMDP (2008) 2 DR6 [50%] blank [50%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:  
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGC
TGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo