Allele Report for DRB1*13:11:01

DRB1*13:11:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*131101 Local Names: HER-2698
IMGT/HLA Acc No: HLA00809 OMIM Entry: *142857
Assigned: 1993-11-07 Sequence Last Modified: 2006-01-12
Source Entries: AJ243898 , AM109992 , X74313 , X75445  
Cells Sequence Derived From: 1083933x , H108 , HER-2698  
Known Ethnic Origin Of Source: Caucasoid
Publications
Anholts JD et al. Hum Immunol 42:15-22 1995. (View abstract)
Dufosse F et al. Tissue Antigens 43:271-3 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR13 [72-90%] DR11 [0-28%] DR14 [0-10%] DR6 [0-6%]
NMDP (2008) 2 DR6 [50%] blank [50%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:  
Protein Sequence (182 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
VESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVE
Nucleotide Sequence Data (549 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAAT
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo