Allele Report for DRB1*13:07:01

DRB1*13:07:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*130701 Local Names: DRB1*13071, DRB1*JJY, DRB1*SHN
IMGT/HLA Acc No: HLA00804 OMIM Entry: *142857
Assigned: 1992-12-15 Sequence Last Modified: 2001-01-12
Source Entries: AF305212 , D13189 , L06847  
Cells Sequence Derived From: JJY , SHN , SLIR1-13  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Lee KW. Hum Immunol 37:229-36 1993. (View abstract)
Kaneshige T et al. Hum Immunol 41:151-9 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1 DR13 [100%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Not assigned
Comments: NN: DR11 DR6 
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo