Allele Report for DRB1*13:02:02

DRB1*13:02:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*130202 Local Names: DRB1*13022, RMAY
IMGT/HLA Acc No: HLA01155 OMIM Entry: *142857
Assigned: 1999-11-25 Sequence Last Modified: 2003-07-12
Source Entries: AF176834 , AF217961  
Cells Sequence Derived From: FM99/810 , RMAY  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Martinetti M et al. Tissue Antigens 56:192-3 2000. (View abstract)
Trejaut J et al. Eur J Immunogenet 28:441-7 2001. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 DR13 [81-97%] DR6 [7-11%]
NMDP (2008) 3081 DR13 [74%] DR6 [17%] DR14 [2%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR6 DR13
Comments:
Protein Sequence (93 aa)
GDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCR
HNYGVGESFTVQR
Nucleotide Sequence Data (279 bps)
GGGGACACCAGACCACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCT
GGACAGATACTTCCATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGG
GGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGCGCCGCGGTGGACACCTACTGCAGA
CACAACTACGGGGTTGGTGAGAGCTTCACAGTGCAGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo