Allele Report for DRB1*13:01:03

DRB1*13:01:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*130103 Local Names: GN00424
IMGT/HLA Acc No: HLA01689 OMIM Entry: *142857
Assigned: 2002-11-28 Sequence Last Modified: 2003-01-17
Source Entries: AY178184 , GU991558  
Cells Sequence Derived From: BY00670 , GN00424  
Known Ethnic Origin Of Source: Oriental
Publications
Lazaro AM et al. Tissue Antigens 66:327-9 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR13 WHO Assigned Type: DR13(6)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 DR13 [90-100%] DR6 [0-7%]
NMDP (2008) 3788 DR13 [81%] DR6 [14%] DR14 [1%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR6 DR13
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo