Allele Report for DRB1*12:38

DRB1*12:38 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DRB1*12 variant
IMGT/HLA Acc No: HLA08908 OMIM Entry: *142857
Assigned: 2012-10-31 Sequence Last Modified: 2013-01-18
Source Entries: KC109817  
Cells Sequence Derived From: ID-1618301  
Known Ethnic Origin Of Source: Mixed
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFHNQEEYVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo