Allele Report for DRB1*12:26

DRB1*12:26 View HGVS Report
Pre-2010 Nomenclature: Local Names: DRB1
IMGT/HLA Acc No: HLA05778 OMIM Entry: *142857
Assigned: 2010-08-31 Sequence Last Modified: 2010-10-15
Source Entries: FR675897  
Cells Sequence Derived From: D10003927  
Known Ethnic Origin Of Source: Oriental
Publications
Li J et al. Tissue Antigens 78:267-270 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFRNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CGTAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo