Allele Report for DRB1*12:21

DRB1*12:21 View HGVS Report
Pre-2010 Nomenclature: DRB1*1221 Local Names: HLA-DRB1*1202V
IMGT/HLA Acc No: HLA04748 OMIM Entry: *142857
Assigned: 2010-01-31 Sequence Last Modified: 2010-04-01
Source Entries: AB542913  
Cells Sequence Derived From: K38708  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEYRAVTELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo