Allele Report for DRB1*12:14

DRB1*12:14 View HGVS Report
Pre-2010 Nomenclature: DRB1*1214 Local Names: DRB1_12V
IMGT/HLA Acc No: HLA02461 OMIM Entry: *142857
Assigned: 2006-02-22 Sequence Last Modified: 2006-04-07
Source Entries: DQ343834  
Cells Sequence Derived From: KS9407622  
Known Ethnic Origin Of Source: Oriental
Publications
Lee HL et al. Int J Immunogenet 35:423-6 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR12 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR12
Comments:
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFHNQEEFVRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo