Allele Report for DRB1*12:13

DRB1*12:13 View HGVS Report
Pre-2010 Nomenclature: DRB1*1213 Local Names: 2005081802
IMGT/HLA Acc No: HLA02382 OMIM Entry: *142857
Assigned: 2005-11-21 Sequence Last Modified: 2006-01-12
Source Entries: DQ250650  
Cells Sequence Derived From: 2005081802  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Jeong SM et al. Tissue Antigens 68:95-7 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR12 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR12
Comments:
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVLLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCTGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo