Allele Report for DRB1*12:11

DRB1*12:11 View HGVS Report
Pre-2010 Nomenclature: DRB1*1211 Local Names: HLA-DRB1*12MVE1102
IMGT/HLA Acc No: HLA02055 OMIM Entry: *142857
Assigned: 2004-12-20 Sequence Last Modified: 2005-01-12
Source Entries: AJ870921 , GQ845416  
Cells Sequence Derived From: CS00023 , MHH0208244  
Known Ethnic Origin Of Source: Caucasoid
Publications
Horn PA et al. Hum Immunol 66:1254-7 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR12 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR12
Comments:
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGELRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGCTCCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo