Allele Report for DRB1*12:08

DRB1*12:08 View HGVS Report
Pre-2010 Nomenclature: DRB1*1208 Local Names: DRB1*12 variant
IMGT/HLA Acc No: HLA01480 OMIM Entry: *142857
Assigned: 2001-05-30 Sequence Last Modified: 2001-07-09
Source Entries: AY033428 , EU812538  
Cells Sequence Derived From: 13365831 , BY00335  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Sheldon MH et al. Tissue Antigens 59:430-2 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR12 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR12
Comments:
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRFLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGAGAGACACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo