Allele Report for DRB1*12:02:03

DRB1*12:02:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*120203 Local Names: HLA-DRB1*1202V1
IMGT/HLA Acc No: HLA03379 OMIM Entry: *142857
Assigned: 2008-05-21 Sequence Last Modified: 2008-10-10
Source Entries: AB436796  
Cells Sequence Derived From: JMDP36K021  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR12 WHO Assigned Type: DR12(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 DR12 [91-100%]
NMDP (2008) 162 DR12 [89%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR12
Comments:
Protein Sequence (89 aa)
RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGGGTGAGTGTTATTTCTTCAATGGGACGGAGCGGGTGCGGTTACTGGAGAGACACTTC
CATAACCAGGAGGAGCTCCTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGTCGC
CGAGTCCTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTATGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo