Allele Report for DRB1*11:96

DRB1*11:96 View HGVS Report
Pre-2010 Nomenclature: Local Names: B09-2131
IMGT/HLA Acc No: HLA05379 OMIM Entry: *142857
Assigned: 2010-06-30 Sequence Last Modified: 2010-07-16
Source Entries: HM217755 , JF309446  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*11:96
Submission 1
Submission 2

Locus Reference
  Virtual entry for DRB1*11:96 
  Individual submission(s) 
Cells Sequence Derived From: B09-2131 , HG00002644  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.5379 (Allele OID)
Publications
Lee KW. Tissue Antigens 77:601-602 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEHWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGCACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors