Allele Report for DRB1*11:153

DRB1*11:153 View HGVS Report
Pre-2010 Nomenclature: Local Names: DRB1*11:131new
IMGT/HLA Acc No: HLA10526 OMIM Entry: *142857
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KF693238  
Cells Sequence Derived From: 13536491  
Known Ethnic Origin Of Source: Caucasoid
Publications
Santos S et al. Tissue Antigens 83:297-298 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEQKRAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo