Allele Report for DRB1*11:137

DRB1*11:137 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DRB1_110228_00949, HIS_NEW_DRB1_110303_01042
IMGT/HLA Acc No: HLA08869 OMIM Entry: *142857
Assigned: 2012-10-31 Sequence Last Modified: 2013-01-18
Source Entries: HG008030 , JQ824784 , JX458924 , KF036214  
Cells Sequence Derived From: DKMS-LSL-DRB1-79 , HG00004764 , HG00004765 , HG00007087  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDSYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACAGCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo