Allele Report for DRB1*11:130

DRB1*11:130 View HGVS Report
Pre-2010 Nomenclature: Local Names: ligh101292
IMGT/HLA Acc No: HLA08286 OMIM Entry: *142857
Assigned: 2012-06-30 Sequence Last Modified: 2013-01-18
Source Entries: JX069944  
Cells Sequence Derived From: ligh101292  
Known Ethnic Origin Of Source: Mixed
Publications
Wowk PF et al. Tissue Antigens 81:469-470 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (90 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEDRRAAVDTYCRHNYGV
VESFTVQRRV
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGACTACTGGAACAGCCAGAAGGACCTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo