Allele Report for DRB1*11:103

DRB1*11:103 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DRB1_682_00323
IMGT/HLA Acc No: HLA06482 OMIM Entry: *142857
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: GU551917 , HQ644417 , JN119545 , JQ824769 , JQ824770  
Cells Sequence Derived From: HG00001058 , HG00002646 , HG00005173 , HG00005174 , HG10011852  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLEQKRGRVDNYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAGCGGGGCCGGGTGGACAACTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo