Allele Report for DRB1*11:83

DRB1*11:83 View HGVS Report
Pre-2010 Nomenclature: DRB1*1183 Local Names: BY00494
IMGT/HLA Acc No: HLA04032 OMIM Entry: *142857
Assigned: 2009-07-31 Sequence Last Modified: 2009-10-19
Source Entries: GQ410113 , JN584532  
Cells Sequence Derived From: BY00494 , HG00003406  
Known Ethnic Origin Of Source: Unknown
Publications
Lazaro AM et al. Tissue Antigens 78:195-202 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEYRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTACCTGGACAGATACTTC
CATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo