Allele Report for DRB1*11:81

DRB1*11:81 View HGVS Report
Pre-2010 Nomenclature: DRB1*1181 Local Names: HistoGenetics HIS_NEW_DRB1_104_00001
IMGT/HLA Acc No: HLA03913 OMIM Entry: *142857
Assigned: 2009-06-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ205616 , GQ994093 , HM362895 , HQ590534 , HQ906932 , JN406484 , JN406485 , JN418846 , JN561764 , JN584533 , JQ824825  
Cells Sequence Derived From: HG00001060 , HG00001887 , HG00002649 , HG00003431 , HG00003432 , HG00003433 , HG00003434 , HG00003435 , HG00005177 , HN-07650-3 , HN-61224-4  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 11 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRQNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACAAAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo