Allele Report for DRB1*11:65:02

DRB1*11:65:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*116502 Local Names: MMarsh1
IMGT/HLA Acc No: HLA03069 OMIM Entry: *142857
Assigned: 2007-08-30 Sequence Last Modified: 2007-10-05
Source Entries: EU090251  
Cells Sequence Derived From: MMarsh1  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Not defined
Publications
Serov Y et al. Tissue Antigens 71:489-90 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEDYWNSQKDILEDERAAVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGACTACTGGAACAGCCAGAAGGACATCCTGGAAGACGAGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGAGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo