Allele Report for DRB1*11:61

DRB1*11:61
Pre-2010 Nomenclature: DRB1*1161 Local Names: 157429, 136837
IMGT/HLA Acc No: HLA02841 OMIM Entry: *142857
Assigned: 2007-02-28 Sequence Last Modified: 2007-07-09
Source Entries: AM490640  
Cells Sequence Derived From: 157429  
Known Ethnic Origin Of Source: Caucasoid
Publications
Longhi E et al. Int J Immunogenet 34:237-39 2007. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFNSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCAACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo