Allele Report for DRB1*11:52

DRB1*11:52 View HGVS Report
Pre-2010 Nomenclature: DRB1*1152 Local Names: novel DRB1*11 allele variant
IMGT/HLA Acc No: HLA01931 OMIM Entry: *142857
Assigned: 2004-05-20 Sequence Last Modified: 2004-07-08
Source Entries: AY574194  
Cells Sequence Derived From: 4334 , 4337  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Ozzella G et al. Tissue Antigens 67:180-2 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR14
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPDEEHWNSQKDLLERRRAEVDTYCRHNYGV
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
CATAACCAGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGCACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTATTGCAGACACAACTACGGGG
TTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo