Allele Report for DRB1*11:49:01

DRB1*11:49:01 View HGVS Report
Pre-2010 Nomenclature: DRB1*1149 Local Names: HLA-DRB1*11
IMGT/HLA Acc No: HLA01848 OMIM Entry: *142857
Assigned: 2003-12-15 Sequence Last Modified: 2004-01-16
Source Entries: AY172512  
Cells Sequence Derived From: 16005 , 16006 , 24115  
Known Ethnic Origin Of Source: Caucasoid
Publications
Garino E et al. Tissue Antigens 64:210-2 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYARFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (267 bps)
CGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTCTA
TAACCAAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGG
AGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTT
GGTGAGAGCTTCACAGTGCAGCGGCGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo