Allele Report for DRB1*11:32

DRB1*11:32 View HGVS Report
Pre-2010 Nomenclature: DRB1*1132 Local Names: MANDRAY Arlette
IMGT/HLA Acc No: HLA00786 OMIM Entry: *142857
Assigned: 1998-03-16 Sequence Last Modified: 2009-07-17
Source Entries: AF011786 , EU146147 , FM994150  
Cells Sequence Derived From: 37479 , MA96401984 , NT00742  
Known Ethnic Origin Of Source: Caucasoid
Publications
Loiseau P et al. Tissue Antigens 52:402-4 1998. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (183 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAVVDTYCRHNYGV
GESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGTGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTCCATCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGTTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACAAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo