Allele Report for DRB1*11:28:02

DRB1*11:28:02 View HGVS Report
Pre-2010 Nomenclature: DRB1*112802 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA03768 OMIM Entry: *142857
Assigned: 2009-04-30 Sequence Last Modified: 2009-07-17
Source Entries: FJ870104 , KC296451  
Cells Sequence Derived From: BY00981 , SZ-30  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Li Z et al. Tissue Antigens 74:350-352 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEENVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAGGAGGAGAACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo