Allele Report for DRB1*11:19:02

DRB1*11:19:02
Pre-2010 Nomenclature: DRB1*111902 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA02019 OMIM Entry: *142857
Assigned: 2004-10-31 Sequence Last Modified: 2005-01-12
Source Entries: AY750899  
Cells Sequence Derived From: CBHLA-DRB1-01  
Known Ethnic Origin Of Source: Oriental
Publications
Li D et al. Tissue Antigens 66:67-8 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR11 WHO Assigned Type: DR11(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 4 DR11 [100%]
NMDP (2008) 1
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR11
Comments:
Protein Sequence (89 aa)
RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEDRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGGAGTACTCTACGTCTGAGTGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTC
TATAACCAAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGA
GGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAGGCGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo